PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A03G1664
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 388aa    MW: 41845.2 Da    PI: 10.0165
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A03G1664genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1444.8e-14310362557
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                  +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++ N++L k+ ee+ ++ +
  Gh_A03G1664 310 RRQRRMIKNRESAARSRARKQAYTLELEAEVAKLKEMNQELLKKQEEMMEMQK 362
                  79****************************************99999988865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.0E-11306370IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.68308359IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.8E-13310360No hitNo description
PfamPF001703.7E-12310362IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.44E-10310360No hitNo description
CDDcd147076.04E-25310364No hitNo description
PROSITE patternPS000360313328IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MGSHLNFKNF GGDGNNGLKP VANSPLVRQS SIYSLTFDEL QSTFGGLGKD FGSMNMDELL  60
RNISTAEETQ SAMTASVSAG EGGGVSGGNL QKQGSLTLPR TLSQKTVDEV WKYLMKESDG  120
GSNNGSTGGE ANLPQRQQTL GTMTLEEFLA RAGVVREDMQ QIGMVNNGGF FADNSALALG  180
FQQANTNNGF ASGVKSSSQL QQQPQPLFPK QQVVAFAPPM HLMNATQLAS PGAKGSVVGI  240
GDPSMNNNLV QTTGLQGGGI GIVGLGSPAS QISSDVVSKN STDTTSPSPV PYIFGRGRKC  300
SANLEKVVER RQRRMIKNRE SAARSRARKQ AYTLELEAEV AKLKEMNQEL LKKQEEMMEM  360
QKNQMLEKAN RPWGRKKQCV RRTITCPW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012480227.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 6 isoform X2
SwissprotQ9M7Q31e-120AI5L6_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 6
TrEMBLA0A0B0P8Y50.0A0A0B0P8Y5_G
STRINGPOPTR_0009s10400.11e-151(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73427129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34000.26e-78abscisic acid responsive elements-binding factor 3